PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca54204.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NF-YB
Protein Properties Length: 290aa    MW: 31551.8 Da    PI: 7.9705
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca54204.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB154.81.5e-481432251597
       NF-YB  15 rimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                 rimkk+lPanakiskdaketvqecvsefisf+t+easd+cqrekrktingddllwa++tlGfedyveplkvyl+++relege+
  Dca54204.1 143 RIMKKALPANAKISKDAKETVQECVSEFISFITGEASDNCQREKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFRELEGER 225
                 9********************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5096610.3246395IPR007527Zinc finger, SWIM-type
PfamPF044342.2E-56593IPR007527Zinc finger, SWIM-type
SMARTSM005758.3E-87097IPR006564Zinc finger, PMZ-type
SuperFamilySSF471131.61E-33142227IPR009072Histone-fold
PfamPF008081.1E-22142199IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.109.1E-44143227IPR009072Histone-fold
PRINTSPR006151.8E-19163181No hitNo description
PRINTSPR006151.8E-19182200No hitNo description
PRINTSPR006151.8E-19201219No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MEWMRRYVMK RNFEKREGAE KVQGNIMPYA QKHVKTVLED AKYCVVVRAT TELFEVDCRG  60
DCQTVNLQTR SCSCYQWDLT GLPCVHVVGA ILKQRLNVED FIDEAYSKAK YLLAYEPVVK  120
PMPGSKQWEK SGLPEPEPPV GRRIMKKALP ANAKISKDAK ETVQECVSEF ISFITGEASD  180
NCQREKRKTI NGDDLLWAMT TLGFEDYVEP LKVYLQRFRE LEGERTGNPI QGNGGGGGGG  240
SSGGVSSGGN GGGYGNGGGG SGGVNNGVMM MGHVIGQSGQ GYGGHGYGAK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A7e-381432201693NF-YB
4csr_A7e-381432201794NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B7e-381432201794NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010644567.14e-55PREDICTED: nuclear transcription factor Y subunit B-3
RefseqXP_003634760.14e-55PREDICTED: nuclear transcription factor Y subunit B-3
TrEMBLD7UAG55e-55D7UAG5_VITVI; Putative uncharacterized protein
STRINGVIT_19s0015g00440.t011e-54(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47640.16e-54nuclear factor Y, subunit B2